Product Price Quantity Subtotal
× FOXO4 $72.03
$72.03
× Bodybuilding oil $69.00
$69.00

Cart totals

Subtotal $141.03
Total $141.03
Proceed to checkout

You May Be Interested In…

AOD9604

$50.01
Product Description AOD 9604, also known as Anti-Obesity Drug 9604, is a synthetic peptide fragment derived from human growth hormone
Add to cart

bac.water for peptide

$74.64
Product Description There are 3 kinds of water, when you order, please notify which one you need. 1.Phosphate buffered saline
Add to cart

Bodybuilding oil

$69.00
Product Description Bodybuilding oil for resales! Welcome to contact with us for list sharing.
Add to cart

BPC 157

$29.08
Product Description Common Name BPC 157 Density 1.4??0.1 g/cm3 Boiling Point 1802.9??65.0 ??C at 760 mmHg Molecular Formula C62H98N16O22 Molecular
Add to cart

Cagrilintide

$28.48
Product Description Cagrelinide is a a cyclic peptide composed of 38 amino acids, with a sequence containing 38 amino acids
Add to cart

CJC-1295 With DAC

$48.61
Product Description Name GLP-1 peptides Purity 99.9% Package 10vials/kit storage cool and dry Certificate
Add to cart

Epithalon

$74.00
Product Description Epithalon is a peptide used to regulate the cell cycle through up-regulation of telomerase activity. The sequence of
Add to cart

Epithalon

$69.34
Product Description Density 1.5??0.1 g/cm3 Boiling Point 959.8??65.0 ??C at 760 mmHg Molecular Formula C14H22N4O9 Molecular Weight 390.346 Flash Point
Add to cart

Follistatin

$69.55
Product Description Follistatin is studied for its role in regulation of muscle growth in mice, also known as GDF-8, a
Add to cart

FOXO4

$72.03
Product Description OXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence
Add to cart

GHK-CU

$26.47
Product Description GHK-CU Certificate
Add to cart

Glow BPC 157 10mg+GHK-CU 50mg+TB500 10mg

$69.68
Product Description BPC 157 10mg GHK-CU 50mg TB500 10mg Certificate
Add to cart