Product Description AOD 9604, also known as Anti-Obesity Drug 9604, is a synthetic peptide fragment derived from human growth hormone

Product Description There are 3 kinds of water, when you order, please notify which one you need. 1.Phosphate buffered saline

Product Description Cagrelinide is a a cyclic peptide composed of 38 amino acids, with a sequence containing 38 amino acids

Product Description Name GLP-1 peptides Purity 99.9% Package 10vials/kit storage cool and dry Certificate

Product Description Follistatin is studied for its role in regulation of muscle growth in mice, also known as GDF-8, a

Product Description OXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence