Showing 1–24 of 34 results

AOD9604

$50.01
Product Description AOD 9604, also known as Anti-Obesity Drug 9604, is a synthetic peptide fragment derived from human growth hormone

bac.water for peptide

$74.64
Product Description There are 3 kinds of water, when you order, please notify which one you need. 1.Phosphate buffered saline

BPC 157

$29.08
Product Description Common Name BPC 157 Density 1.4??0.1 g/cm3 Boiling Point 1802.9??65.0 ??C at 760 mmHg Molecular Formula C62H98N16O22 Molecular

Cagrilintide

$28.48
Product Description Cagrelinide is a a cyclic peptide composed of 38 amino acids, with a sequence containing 38 amino acids

CJC-1295 With DAC

$48.61
Product Description Name GLP-1 peptides Purity 99.9% Package 10vials/kit storage cool and dry Certificate

Epithalon

$74.00
Product Description Epithalon is a peptide used to regulate the cell cycle through up-regulation of telomerase activity. The sequence of

Epithalon

$69.34
Product Description Density 1.5??0.1 g/cm3 Boiling Point 959.8??65.0 ??C at 760 mmHg Molecular Formula C14H22N4O9 Molecular Weight 390.346 Flash Point

Follistatin

$69.55
Product Description Follistatin is studied for its role in regulation of muscle growth in mice, also known as GDF-8, a

FOXO4

$72.03
Product Description OXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence

GHK-CU

$26.47
Product Description GHK-CU Certificate

Glow BPC 157 10mg+GHK-CU 50mg+TB500 10mg

$69.68
Product Description BPC 157 10mg GHK-CU 50mg TB500 10mg Certificate

Glutathione 1500mg*10vials

$79.99
Product Description Items Specifications Product Name Glutathione CAS No. C70-18-8 Formula C10H17N3O6S Molecular Weight 307.32348 EINECS 200-725-4 Density 1.441 Boiling

HCG

$49.77
Product Description Human Chorionic Gonadotropin (HCG) is a naturally occurring peptide hormone predominantly produced during pregnancy by the placenta. It

hyaluronic acid peptide

$72.47
Product Description Items Specifications Product Name Hyaluronic Acid Powder Cas No 9004-61-9 Einecs 232-678-0 MF C14H22NNaO11 MW 403.31 Melting Point

IGF-1LR3

$69.41
Product Description Items Specifications Product Name IGF-1LR3 Other Names CL281;LR3-IGF1;IDF-1 LR3;IGF LR3-1;IGF-1 LR3;IGF-1Lr3 Igtropin;LR3-IGF1 (100mcg/vial;Recombinant Human Insulin-like Growth Factor-1 LR3,

Ipamorelin

$80.21
Product Description Ipamorelin is a pentapeptide composed of five amino acids that mimic the action of ghrelin, a hormone that

KissPeptin-10

$73.98
Product Description Kisspeptin, also known as metastin, is a naturally occurring protein in humans with crucial functions in hormone signaling

KPV

$32.57
Product Description [Molecular formula] C16H30N4O4 [Molecular weight] 342.43 [Appearance] White powder [Purity] 99% [Function] 1. Accelerate wound healing and reduce

Lipo-C

$27.54
Product Description 10 mL vial Amount per mL: Methionine 25mg Inositol 50mg Choline 50mg B6 (Pyridoxine) 25mg B5 (Dexpanthenol) 25mg

LL37

$69.37
Product Description The LL-37 precursor consists of a signal peptide, cathelin conserved region, and 37 amino acid residues that, when

MOTS-c

$80.00
Product Description Items Specifications Product Name MOTS-C CAS number 1627580-64-6 Purity 99% Molecular Weight 2174.62 Molecular Formula C101h152n28o22s2 Application Weight

NAD

$31.98
Product Description NAD, also known as nicotinamide adenine dinucleotide, is an essential bioactive molecule in our body. Its main functions

NAD+

$72.00

NAD is the abbreviation of Nicotinamide Adenine Dinucleotide. NAD is white powder, easily soluble in water, in soluble in organic solvents. NAD exists in two forms: oxidized form NAD+ and reduced form NADH. In metabolism, NAD is a cofactor, involved in redox reactions, by carrying electrons from one reaction to another. NAD powder is extracted from yeast. NAD powder is helpful for improving metabolism. It can potentially prolong the lifespan of cells, thus it may have anti-aging effect. NAD powder can be used in supplements, and it is also be added to pharmaceuticals for treatment of various diseases.

PT 141

$50.94
Product Description PT 141, also known as Bremelanotide, is a synthetic peptide developed for its unique properties related to sexual